Protein coding transcript 98994

• Transcript: Ll_transcript_529533
• CDS coordinates: 402-890 (+)
• Peptide sequence: MLCHNFTKVKIPSKLYQTTINNIFNLNLNITSCMQREELNAYGELYIQRFPKMKIKIVDGSSLAAAIVLNSIPKGTNQVLLRGNFNKVSLAIANALCERNVQVVILYKEELEKLQGKVTRSNGNLVLSPIQTPKVNLFCNRINKISLTNSNYFLHIQCFKLL*
• ORF Type: complete

Annotations of Ll_transcript_529533

• Blastp: Protein CER1-like 1 from Arabidopsis with 48.57% of identity
• Blastx: Protein CER1-like 1 from Arabidopsis with 47.27% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G02190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462067.1)
• Pfam: WAX2 C-terminal domain (PF12076.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;