| Transcript | Ll_transcript_529534 |
|---|---|
| CDS coordinates | 105-431 (+) |
| Peptide sequence | MGIIMDTKFVILTPWIGHSIYSLTSNERDPMYYLVFPFMLVRMMHNQIWISVSRYQTAKGNNKIVDKAIEFDQVDRETNWFITLNPFLSFLNYFYEKLYSIYIYMIFS* |
| ORF Type | complete |
| Blastp | Protein ECERIFERUM 1 from Arabidopsis with 53.95% of identity |
|---|---|
| Blastx | Protein ECERIFERUM 1 from Arabidopsis with 53.95% of identity |
| Eggnog | WAX2-like(ENOG4111G66) |
| Kegg | Link to kegg annotations (AT1G02205) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462067.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer