Protein coding transcript 99000

• Transcript: Ll_transcript_529524
• CDS coordinates: 1-741 (+)
• Peptide sequence: FHIMASKPGILTDWPWKPLGSFKFVILTPWIGHSIYSLTSNERDPMYYLVFPFMLVRMMHNQIWISVSRYQTAKGNNKIVDKAIEFDQVDRETNWDDQILFTALLYYIGYMIFPFAAHLPWWRIEGVILTALLHAGPVEFIYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAEHLAYFTLFSIPMLTTLFTRTSSIVALYGYVFYIDLMNNMGHCNFEFFPKKLFSLFPLFKYLTYTPS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_529524

• Blastp: Protein ECERIFERUM 1 from Arabidopsis with 67.48% of identity
• Blastx: Protein ECERIFERUM 1 from Arabidopsis with 67.48% of identity
• Eggnog: WAX2-like(ENOG4111G66)
• Kegg: Link to kegg annotations (AT1G02205)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462067.1)
• Pfam: Fatty acid hydroxylase superfamily (PF04116.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;