Protein coding transcript 99004

• Transcript: Ll_transcript_529529
• CDS coordinates: 239-844 (+)
• Peptide sequence: MKIKIVDGSSLAAAIVLNSIPKGTNQVLLRGNFNKVSLAIANALCERNVQVVILYKEELEKLQGKVTRSNGNLVLSPIQTPKIWLVGDGWDEDEQINAPKGTLFIPFSHFPPKKMRKDCFYHYTPSMIIPNTFTNLHSCENWLPRRVMSGWRIAGIVHALEGWNVNECGYTILSINKVWEATIRHGFQPLKIPIDLYTNIA*
• ORF Type: complete

Annotations of Ll_transcript_529529

• Blastp: Protein ECERIFERUM 1 from Arabidopsis with 51.76% of identity
• Blastx: Protein ECERIFERUM 1 from Arabidopsis with 53.17% of identity
• Eggnog: WAX2-like(ENOG4111G66)
• Kegg: Link to kegg annotations (AT1G02205)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462067.1)
• Pfam: WAX2 C-terminal domain (PF12076.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;