Protein coding transcript 99081

• Transcript: Ll_transcript_528127
• CDS coordinates: 223-639 (+)
• Peptide sequence: MGYIGAHGVTALHRYKYSGVDHSYLAKYVLQPFWTRFVNFFPLWMPPNMITLMGFMFLLLSALLGYIYSPQLDSAPPRWVSFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGDFLTPHFSFYIFSSCVHLYY*
• ORF Type: complete

Annotations of Ll_transcript_528127

• Blastp: Choline/ethanolaminephosphotransferase 1 from Arabidopsis with 86.47% of identity
• Blastx: Choline/ethanolaminephosphotransferase 1 from Arabidopsis with 67.29% of identity
• Eggnog: phosphotransferase 1(COG5050)
• Kegg: Link to kegg annotations (AT1G13560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417726.1)
• Pfam: CDP-alcohol phosphatidyltransferase (PF01066.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;