Transcript | Ll_transcript_528135 |
---|---|
CDS coordinates | 1632-2069 (+) |
Peptide sequence | MIAFAVIPTVTLNVSNVYKVVKARNGSMPLALAMLYPFVVLVGGVLVWDYLSPSDILGAYPHLAIIGSGLIFGYLVGRMILAHLCDEPKGLKTGMCMVLSYFICVGMLSLNNFFKMLYLFIFGYFSHCFLLIRKEILLGKEGESC* |
ORF Type | complete |
Blastp | Choline/ethanolaminephosphotransferase 1 from Arabidopsis with 77.23% of identity |
---|---|
Blastx | Choline/ethanolaminephosphotransferase 1 from Arabidopsis with 77.84% of identity |
Eggnog | phosphotransferase 1(COG5050) |
Kegg | Link to kegg annotations (AT1G13560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417726.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer