Protein coding transcript 99089

• Transcript: Ll_transcript_528126
• CDS coordinates: 189-650 (+)
• Peptide sequence: MCGRTTFWFWLISAITFYGATWEHFFTNTLILPVVNGPTEGLMMIYVSHFFTAIVGSEWWAHQFGESLPFLNWLPFFAGIPTYAAVLFLMIAFGVIPTVTLNVSNVYKVVKARNGSMLLALAMLYPFVVLVGGVLVWDYLSPSDILRAYPHLAI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_528126

• Blastp: Choline/ethanolaminephosphotransferase 1 from Arabidopsis with 72.73% of identity
• Blastx: Choline/ethanolaminephosphotransferase 1 from Arabidopsis with 76.5% of identity
• Eggnog: phosphotransferase 1(COG5050)
• Kegg: Link to kegg annotations (AT1G13560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433468.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;