Protein coding transcript 99130

• Transcript: Ll_transcript_529628
• CDS coordinates: 303-776 (+)
• Peptide sequence: MAAQDYTFGPYKIHQNEVFYSTHLSYAMVNLRPLLPGHVLICPKREVKRFVDLTVDETSDLWLTAQKIGRQLESYHKASSLTFAIQDGPQAGQTVPHVHIHVVPRKGGDFENNDEIYDAMDEKEKELKQKLDLDKERKDRSLEEMSQEAAEYRKLFL*
• ORF Type: complete

Annotations of Ll_transcript_529628

• Blastp: Bifunctional bis(5'-adenosyl)-triphosphatase/adenylylsulfatase FHIT from Arabidopsis with 76.13% of identity
• Blastx: Bifunctional bis(5'-adenosyl)-triphosphatase/adenylylsulfatase FHIT from Arabidopsis with 78.15% of identity
• Eggnog: histidine triad (hIT) protein(COG0537)
• Kegg: Link to kegg annotations (AT5G58240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439570.1)
• Pfam: HIT domain (PF01230.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;