Protein coding transcript 99187

• Transcript: Ll_transcript_529296
• CDS coordinates: 3-317 (+)
• Peptide sequence: LTYNTENIIAIGFPAGGMSSGFVGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCQSAYSWLKQDIENVVV
• ORF Type: internal

Annotations of Ll_transcript_529296

• Blastp: Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A from Arabidopsis with 86.67% of identity
• Blastx: Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A from Arabidopsis with 86.67% of identity
• Eggnog: dual specificity phosphatase(COG2453)
• Kegg: Link to kegg annotations (AT3G19420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014513857.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;