Protein coding transcript 99280

• Transcript: Ll_transcript_530147
• CDS coordinates: 333-686 (+)
• Peptide sequence: MASKILANLIVMGGGILARAVVQAYRQALTNASKNGVAQETIQNTIRRASKVMTEQEAQQILGVTEETPWEEIIRKYNTLFENNAKNGSFYLQSKVHRAKECLESFHQAKDQGTSPP*
• ORF Type: complete

Annotations of Ll_transcript_530147

• Blastp: Mitochondrial import inner membrane translocase subunit PAM16 like 2 from Arabidopsis with 71.05% of identity
• Blastx: Mitochondrial import inner membrane translocase subunit PAM16 like 2 from Arabidopsis with 71.05% of identity
• Eggnog: mitochondrial import inner membrane translocase, subunit(ENOG411286G)
• Kegg: Link to kegg annotations (AT3G59280)
• CantataDB: Link to cantataDB annotations (CNT0002650)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420320.1)
• Pfam: Pam16 (PF03656.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;