Transcript | Ll_transcript_530149 |
---|---|
CDS coordinates | 3-635 (+) |
Peptide sequence | IFQTFLLSLFPEQTQVLEIPNWNPSLCYRSLIFILYTFPSFPNKIDAAVVVSHSHKDQLVPENSIWGHNPKFSDSSRKNPSFSITSVHFVDSQAMASKILANLIVMGGGILARAVVQAYRQALANASKNGVAQETIQNTLRRASKVMTEQEAQQILGVTEETPWEEIMRKYNTMFENNAKNGSFYLQSKVYRAKECLESFKAKDQGTAPR* |
ORF Type | 5prime_partial |
Blastp | Mitochondrial import inner membrane translocase subunit PAM16 like 2 from Arabidopsis with 70.18% of identity |
---|---|
Blastx | Mitochondrial import inner membrane translocase subunit PAM16 like 2 from Arabidopsis with 70.18% of identity |
Eggnog | mitochondrial import inner membrane translocase, subunit(ENOG411286G) |
Kegg | Link to kegg annotations (AT3G59280) |
CantataDB | Link to cantataDB annotations (CNT0002650) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420320.1) |
Pfam | Pam16 (PF03656.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer