Protein coding transcript 993

• Transcript: Ll_transcript_499372
• CDS coordinates: 3-338 (+)
• Peptide sequence: CSGHGFKLLASNYLGLHETSENPFYKEVHGLIETTQVTPAEVAEELMKDDDANVALQGLAAFLKRKRVEEIEMKDERVDDHKVHEAKKLRSNTDVSRIAKEIEELQGISFY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_499372

• Blastp: AAA-ATPase At2g18193 from Arabidopsis with 47.37% of identity
• Blastx: AAA-ATPase At2g18193 from Arabidopsis with 47.37% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT2G18193)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421799.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;