Protein coding transcript 9934

• Transcript: Ll_transcript_477946
• CDS coordinates: 294-602 (+)
• Peptide sequence: MWFTSGRKLLSLISAVVLLLILIYSHCCHVQAIRVFPGENAVAKVEFSGHRIIIENSKTKQKEDLFSKYFSGKRNFGLSNRTQKVIDESKRRVPSCPDPLHN*
• ORF Type: complete

Annotations of Ll_transcript_477946

• Blastp: CLAVATA3/ESR (CLE)-related protein 27 from Arabidopsis with 37.5% of identity
• Blastx: CLAVATA3/ESR (CLE)-related protein 27 from Arabidopsis with 42.47% of identity
• Eggnog: NA(ENOG411187R)
• Kegg: Link to kegg annotations (AT3G25905)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460373.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;