Transcript | Ll_transcript_477946 |
---|---|
CDS coordinates | 294-602 (+) |
Peptide sequence | MWFTSGRKLLSLISAVVLLLILIYSHCCHVQAIRVFPGENAVAKVEFSGHRIIIENSKTKQKEDLFSKYFSGKRNFGLSNRTQKVIDESKRRVPSCPDPLHN* |
ORF Type | complete |
Blastp | CLAVATA3/ESR (CLE)-related protein 27 from Arabidopsis with 37.5% of identity |
---|---|
Blastx | CLAVATA3/ESR (CLE)-related protein 27 from Arabidopsis with 42.47% of identity |
Eggnog | NA(ENOG411187R) |
Kegg | Link to kegg annotations (AT3G25905) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460373.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer