Transcript | Ll_transcript_528928 |
---|---|
CDS coordinates | 1137-1481 (+) |
Peptide sequence | MVPEFSKLGAYFSFSGFLMSLKASKAKRMLKMVPSDRILLETDAPDALPTSNIDSLFFVEGDTSLPKELHDQRTSSSTSTSFSNSSQVVTDASMLSKETLNHPANIRSVCSSCL* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Uncharacterized metal-dependent hydrolase YabD from Bacillus with 38.57% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000065) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442900.1) |
Pfam | TatD related DNase (PF01026.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer