Protein coding transcript 99351

• Transcript: Ll_transcript_528929
• CDS coordinates: 138-629 (+)
• Peptide sequence: MMKLFDAHCHLQDPRILSKTPNLIKTAQNSGVVHFVVNGVCEQDWHLVKDLAQTYPSIIPSFGLHPWYVADRSPNWFKTLKEYLDSTPSAAVGEIGVDKGSHGRTIDFSEQVGVLKQQLELAKDLNKPASVHCVRAFGDLLELMKYEYLISLFCFNCYLKNCS*
• ORF Type: complete

Annotations of Ll_transcript_528929

• Blastp: Uncharacterized metal-dependent hydrolase YcfH from Escherichia with 26.47% of identity
• Blastx: Uncharacterized metal-dependent hydrolase YabD from Bacillus with 27.33% of identity
• Eggnog: tatd family(COG0084)
• Kegg: Link to kegg annotations (JW1086)
• CantataDB: Link to cantataDB annotations (CNT0000065)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442900.1)
• Pfam: TatD related DNase (PF01026.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;