Transcript | Ll_transcript_528929 |
---|---|
CDS coordinates | 138-629 (+) |
Peptide sequence | MMKLFDAHCHLQDPRILSKTPNLIKTAQNSGVVHFVVNGVCEQDWHLVKDLAQTYPSIIPSFGLHPWYVADRSPNWFKTLKEYLDSTPSAAVGEIGVDKGSHGRTIDFSEQVGVLKQQLELAKDLNKPASVHCVRAFGDLLELMKYEYLISLFCFNCYLKNCS* |
ORF Type | complete |
Blastp | Uncharacterized metal-dependent hydrolase YcfH from Escherichia with 26.47% of identity |
---|---|
Blastx | Uncharacterized metal-dependent hydrolase YabD from Bacillus with 27.33% of identity |
Eggnog | tatd family(COG0084) |
Kegg | Link to kegg annotations (JW1086) |
CantataDB | Link to cantataDB annotations (CNT0000065) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442900.1) |
Pfam | TatD related DNase (PF01026.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer