| Transcript | Ll_transcript_528936 |
|---|---|
| CDS coordinates | 3306-3650 (+) |
| Peptide sequence | MVPEFSKLGAYFSFSGFLMSLKASKAKRMLKMVPSDRILLETDAPDALPTSNIDSLFFVEGDTSLPKELHDQRTSSSTSTSFSNSSQVVTDASMLSKETLNHPANIRSVCSSCL* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Uncharacterized metal-dependent hydrolase YabD from Bacillus with 38.57% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0000065) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019442900.1) |
| Pfam | TatD related DNase (PF01026.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer