Protein coding transcript 9936

• Transcript: Ll_transcript_478392
• CDS coordinates: 1386-2132 (+)
• Peptide sequence: MAGSCAHLAMVNSSWTKSHIEKLWGVPDRIKRVYPPCDTSGLQVLPLERSAEIPTIISVAQFRPEKAHSLQLEAFSAAFKRLDSTLPKPKLQFVGSCRNKSDEERLEMLKRKALELNVNEQVEFHKNITYRELVRLLGGAVAGIHSMTDEHFGISVVEYMAAGAIPIAHNSAGPKMDIVLAEDGEQTGFLAWNIDEYADAISRIIRMPEKERLLMASAARKRARRFSEQRFYDDFKAALRPILCHVSK*
• ORF Type: complete

Annotations of Ll_transcript_478392

• Blastp: GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase from Arabidopsis with 73.66% of identity
• Blastx: GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase from Arabidopsis with 73% of identity
• Eggnog: Glycosyl transferase (Group 1(COG0438)
• Kegg: Link to kegg annotations (AT2G40190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429075.1)
• Pfam: Glycosyl transferases group 1 (PF00534.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;