Transcript | Ll_transcript_499364 |
---|---|
CDS coordinates | 2-298 (+) |
Peptide sequence | RFGGLGFMFQKGSPIAKDVSKAILQLLEQGEIKKLEDKWLNPSSECTNSKISTNAETLKLGNLWVLYAISGGISTICLVLPTIYSLKYSQTPQNHAQGN |
ORF Type | internal |
Blastp | Glutamate receptor 3.4 from Arabidopsis with 40.74% of identity |
---|---|
Blastx | Glutamate receptor 3.4 from Arabidopsis with 40.74% of identity |
Eggnog | PBPe(ENOG410ZZ8P) |
Kegg | Link to kegg annotations (AT1G05200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447196.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer