Protein coding transcript 99402

• Transcript: Ll_transcript_530243
• CDS coordinates: 332-760 (+)
• Peptide sequence: MWYRACKTCNKKVTESIGAGYWCEGCQKNDDQCNLRYILVVKVSDASGEAFISVFNEEAEKIVGCSADELDILKSQDGEDSPYQMKLKQATWVPHLLRVSVTQNEYNNEKRQRITARAIVPVDFATESKLLLEDISKMGVSQ*
• ORF Type: complete

Annotations of Ll_transcript_530243

• Blastp: Replication protein A 70 kDa DNA-binding subunit B from Oryza sativa with 71.01% of identity
• Blastx: Replication protein A 70 kDa DNA-binding subunit B from Oryza sativa with 69.87% of identity
• Eggnog: DNA replication(COG1599)
• Kegg: Link to kegg annotations (4332052)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451738.1)
• Pfam: Replication factor-A C terminal domain (PF08646.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;