Protein coding transcript 99407

• Transcript: Ll_transcript_530585
• CDS coordinates: 73-831 (+)
• Peptide sequence: MLNQSSSRKSFIDSSITTARLYGFHGIDLYGAWPREGTELVNFGNLLKEWRAAITSEARNSSKPELILVMAGYYLKASDSLSYPFDLMQRNLDWVHFVAYDDYVPSKDNVTGFHAALYGPPTWDNTDSGIKEWRKRGFSSSKLVIGLPYHGYAWTPVNPGSSGVGAEASGPAITKDGSMAYKLIKSYIRSFGDGVVSHYNDTFVVNQFKVASITWVNFDDVGTIKAKVSYARKNGLLGYNVFQVGNDDNWVL*
• ORF Type: complete

Annotations of Ll_transcript_530585

• Blastp: Chitotriosidase-1 from Homo with 30.99% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 51.15% of identity
• Eggnog: chitinase(COG3325)
• Kegg: Link to kegg annotations (1118)
• CantataDB: Link to cantataDB annotations (CNT0000159)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020236074.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;