Transcript | Ll_transcript_530565 |
---|---|
CDS coordinates | 73-831 (+) |
Peptide sequence | MLNQSSSRKSFIDSSITTARLYGFHGIDLYGAWPREGTELVNFGNLLKEWRAAITSEARNSSKPELILVMAGYYLKASDSLSYPFDLMQRNLDWVHFVAYDDYVPSKDNVTGFHAALYGPPTWDNTDSGIKEWRKRGFSSSKLVIGLPYHGYAWTPVNPGSSGVGAEASGPAITKDGSMAYKLIKSYIRSFGDGVVSHYNDTFVVNQFKVASITWVNFDDVGTIKAKVSYARKNGLLGYNVFQVGNDDNWVL* |
ORF Type | complete |
Blastp | Chitotriosidase-1 from Homo with 30.99% of identity |
---|---|
Blastx | Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 60.91% of identity |
Eggnog | chitinase(COG3325) |
Kegg | Link to kegg annotations (1118) |
CantataDB | Link to cantataDB annotations (CNT0000159) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020236074.1) |
Pfam | Glycosyl hydrolases family 18 (PF00704.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer