Protein coding transcript 99465

• Transcript: Ll_transcript_529839
• CDS coordinates: 1-936 (+)
• Peptide sequence: VVTALATQNSAFSLLVIVKSERQNCGHSRLQTGSSSFQDEGEDLEEQPLIRSRSRLASLGSTESANNVEVIEASTVASIGPQDSSNPPQHDRNSFPDEWGGISSEEHDEAVMLEAAMFGGIPERSGYSYAYAPHEFMQSRGIFPRPTPRPPSPSLTAQRLIREQQDDEFLAALQADREKELKAIEEAEAVREEERRKEEESHRKLQEEMELETQLAAKEVSLPPEPSSDDENAVNLLVRMPDGSRRGRRFLRSDKLQSLFDFIDIGRVVKPGSYRLVRPYPRRAFSYEESKSTLEELGLTNKQEALFLELI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_529839

• Blastp: Plant UBX domain-containing protein 8 from Arabidopsis with 58.45% of identity
• Blastx: Plant UBX domain-containing protein 8 from Arabidopsis with 58.45% of identity
• Eggnog: Fas associated factor family member 2(ENOG410XSFS)
• Kegg: Link to kegg annotations (AT4G11740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424336.1)
• Pfam: UBX domain (PF00789.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;