Protein coding transcript 99466

• Transcript: Ll_transcript_529841
• CDS coordinates: 682-1068 (+)
• Peptide sequence: MHNLALLKDPLFLNCFLLLHLSLFCQELETQLAAKEVSLPPEPSSDDENAVNLLVRMPDGSRRGRRFLRSDKLQSLFDFIDIGRVVKPGSYRLVRPYPRRAFSYEESKSTLEELGLTNKQEALFLELI*
• ORF Type: complete

Annotations of Ll_transcript_529841

• Blastp: Plant UBX domain-containing protein 8 from Arabidopsis with 75.79% of identity
• Blastx: Plant UBX domain-containing protein 8 from Arabidopsis with 75.79% of identity
• Eggnog: Fas associated factor family member 2(ENOG410XSFS)
• Kegg: Link to kegg annotations (AT4G11740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421722.1)
• Pfam: UBX domain (PF00789.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;