Transcript | Ll_transcript_529841 |
---|---|
CDS coordinates | 682-1068 (+) |
Peptide sequence | MHNLALLKDPLFLNCFLLLHLSLFCQELETQLAAKEVSLPPEPSSDDENAVNLLVRMPDGSRRGRRFLRSDKLQSLFDFIDIGRVVKPGSYRLVRPYPRRAFSYEESKSTLEELGLTNKQEALFLELI* |
ORF Type | complete |
Blastp | Plant UBX domain-containing protein 8 from Arabidopsis with 75.79% of identity |
---|---|
Blastx | Plant UBX domain-containing protein 8 from Arabidopsis with 75.79% of identity |
Eggnog | Fas associated factor family member 2(ENOG410XSFS) |
Kegg | Link to kegg annotations (AT4G11740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421722.1) |
Pfam | UBX domain (PF00789.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer