Protein coding transcript 99487

• Transcript: Ll_transcript_529999
• CDS coordinates: 292-897 (+)
• Peptide sequence: MPSDTKGDRKATLDAASWFFNVVTSVGIIIVNKALMATYGFTFATTLTGLHFATTTLLTTVLKSLGYIQSSHIPLADIIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCFLEVVLDKVRYSRDTKLSITLVLLGVAVCTVTDVSVNAKGFIAAAIAVWSTALQQYYVHFLQRKYSVGSFNLLGHTAPAQAASLLL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_529999

• Blastp: UDP-rhamnose/UDP-galactose transporter 5 from Arabidopsis with 83.76% of identity
• Blastx: UDP-rhamnose/UDP-galactose transporter 5 from Arabidopsis with 83.76% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430928.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;