Protein coding transcript 99490

• Transcript: Ll_transcript_530002
• CDS coordinates: 2060-2452 (+)
• Peptide sequence: MDYWLTNKRVDAYNYGLTSILFIIMSCTIAVGTNLSQFICIGRFTAVTFQVLGHMKTILVLILGFIFFGKDGLNLQVVLGMFIAILGMVWYGNASSKPGGKEHRNFSIPATTKAPDYSAVPVSTEPDEKV*
• ORF Type: complete

Annotations of Ll_transcript_530002

• Blastp: UDP-rhamnose/UDP-galactose transporter 4 from Arabidopsis with 74.62% of identity
• Blastx: UDP-rhamnose/UDP-galactose transporter 4 from Arabidopsis with 77.44% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430220.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;