Protein coding transcript 99530

• Transcript: Ll_transcript_528697
• CDS coordinates: 474-872 (+)
• Peptide sequence: MFKLSNASQENCENFHTFSLHSCVRLVKEHLNWETKSELKSEVLHGIKEIGSVLYWMGLLDIVMRETDTMSFMQTAPWLGFLPGADGQILTSPDGGDSPVVSLFKSTAAAMLSYPGCPSPTSFQIMSKQAEAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_528697

• Blastp: Protein PIR from Arabidopsis with 66.67% of identity
• Blastx: Protein PIR from Arabidopsis with 66.67% of identity
• Eggnog: cytoplasmic FMR1 interacting protein(ENOG410XPKW)
• Kegg: Link to kegg annotations (AT5G18410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418762.1)
• Pfam: Cytoplasmic Fragile-X interacting family (PF05994.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;