Transcript | Ll_transcript_528697 |
---|---|
CDS coordinates | 474-872 (+) |
Peptide sequence | MFKLSNASQENCENFHTFSLHSCVRLVKEHLNWETKSELKSEVLHGIKEIGSVLYWMGLLDIVMRETDTMSFMQTAPWLGFLPGADGQILTSPDGGDSPVVSLFKSTAAAMLSYPGCPSPTSFQIMSKQAEAA |
ORF Type | 3prime_partial |
Blastp | Protein PIR from Arabidopsis with 66.67% of identity |
---|---|
Blastx | Protein PIR from Arabidopsis with 66.67% of identity |
Eggnog | cytoplasmic FMR1 interacting protein(ENOG410XPKW) |
Kegg | Link to kegg annotations (AT5G18410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418762.1) |
Pfam | Cytoplasmic Fragile-X interacting family (PF05994.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer