Protein coding transcript 99546

• Transcript: Ll_transcript_528700
• CDS coordinates: 351-806 (+)
• Peptide sequence: MKLHFSIVSLVLLIVILSLLGLVVADLKSDAQVLLEFSSSVPHGPRLNWNDTSSICTSWIGVTCNSNRTRVIGLTLPGIGLTGSIPENNIEKLDALRVLSLHSNGLKGNLPSNILSIPSLQFAHLQHNNFSGLIPSSVSPKLIALETFLLTS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_528700

• Blastp: Probable inactive receptor kinase At5g58300 from Arabidopsis with 56.3% of identity
• Blastx: Probable inactive receptor kinase At5g58300 from Arabidopsis with 60.66% of identity
• Eggnog: inactive receptor kinase(ENOG4111F0S)
• Kegg: Link to kegg annotations (AT5G58300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437273.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;