Transcript | Ll_transcript_528648 |
---|---|
CDS coordinates | 410-907 (+) |
Peptide sequence | MNYFPQGHDYTQEGLDDAKHSSSCCSPCEAEEYSLELTDNYPLDDEIGRRLSHMIPIPHVPKINGEIPSTDEATSDHQRLLDRLQLYDFVEHMVQGDGNCQFRALSDQLYNTPDHHKFVRRQIVNQLKSHPEIYEGYVPMEYSDYLEKMSKYESTLPFYLHMKFL* |
ORF Type | complete |
Blastp | OTU domain-containing protein DDB_G0284757 from Dictyostelium with 36.17% of identity |
---|---|
Blastx | OTU domain-containing protein DDB_G0284757 from Dictyostelium with 31.65% of identity |
Eggnog | OTU-like cysteine protease(ENOG4111GFM) |
Kegg | Link to kegg annotations (DDB_G0284757) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430647.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer