Protein coding transcript 99703

• Transcript: Ll_transcript_528071
• CDS coordinates: 116-745 (+)
• Peptide sequence: MFLSDMSGRTPLYRKAFVFFSSPIPRELVMEIKKDARVLPRIGALREMNLEYFAIDSQGFITNNERALEQLFGDEEDNRKAVACLNVMATRVATVFASLREFPFVRFRAAKSIDATTMTTFRDLIPTKLAAGVWDCLMKYKKSIPNFPQSETCELLIIDRTVDQIAPVIHEWTYDAMCHDLLNMEGNKYVHEASERLPDKMTNFISKNKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_528071

• Blastp: SNARE-interacting protein KEULE from Arabidopsis with 70.78% of identity
• Blastx: SNARE-interacting protein KEULE from Arabidopsis with 71.02% of identity
• Eggnog: Vacuolar Protein(COG5158)
• Kegg: Link to kegg annotations (AT1G12360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446659.1)
• Pfam: Sec1 family (PF00995.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;