Protein coding transcript 99742

• Transcript: Ll_transcript_528974
• CDS coordinates: 431-1210 (+)
• Peptide sequence: MIHSSLYNSNPSSSRAFIRDGLASTHSLVFESEKGELVKCPTETTRVGKNEISEAKALAALKNHSEAERRRRERINGHFETLRGLVPSTEKMDKATLLAEVISQVKELKKNAMEASKGLIIPKDSDEVKVEPYDDEEGEGDGSVSYKASICCDYTPEILSDLRQTLDALKLKLMRTEISTLGNRMKNVFIFKCCKGDITNIEACQALQISVQQALSSVVNKASSSLEYLPRTSYPNKRRRLCSIETSTNSCNHESCSCS*
• ORF Type: complete

Annotations of Ll_transcript_528974

• Blastp: Transcription factor bHLH30 from Arabidopsis with 50% of identity
• Blastx: Putative transcription factor bHLH107 from Arabidopsis with 38.29% of identity
• Eggnog: Transcription factor(ENOG410YEFC)
• Kegg: Link to kegg annotations (AT1G68810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416260.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;