Transcript | Ll_transcript_528974 |
---|---|
CDS coordinates | 431-1210 (+) |
Peptide sequence | MIHSSLYNSNPSSSRAFIRDGLASTHSLVFESEKGELVKCPTETTRVGKNEISEAKALAALKNHSEAERRRRERINGHFETLRGLVPSTEKMDKATLLAEVISQVKELKKNAMEASKGLIIPKDSDEVKVEPYDDEEGEGDGSVSYKASICCDYTPEILSDLRQTLDALKLKLMRTEISTLGNRMKNVFIFKCCKGDITNIEACQALQISVQQALSSVVNKASSSLEYLPRTSYPNKRRRLCSIETSTNSCNHESCSCS* |
ORF Type | complete |
Blastp | Transcription factor bHLH30 from Arabidopsis with 50% of identity |
---|---|
Blastx | Putative transcription factor bHLH107 from Arabidopsis with 38.29% of identity |
Eggnog | Transcription factor(ENOG410YEFC) |
Kegg | Link to kegg annotations (AT1G68810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416260.1) |
Pfam | Helix-loop-helix DNA-binding domain (PF00010.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer