Protein coding transcript 9976

• Transcript: Ll_transcript_478089
• CDS coordinates: 1-390 (+)
• Peptide sequence: KGIIGDGQDVLVRVHSECLTGDIFGSARCDCGNQLALAMQQIEAAGRGVLVYLRGHEGRGIGLGHKLRAYNLQDDGRDTVEANEELGLPVDSREYGIGAQVILVQINDDLNIEHLILAPRVFSFKLMLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_478089

• Blastp: Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic from Arabidopsis with 94.12% of identity
• Blastx: Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic from Arabidopsis with 94.12% of identity
• Eggnog: Catalyzes the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate (By similarity)(COG0108)
• Kegg: Link to kegg annotations (AT5G64300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445549.1)
• Pfam: GTP cyclohydrolase II (PF00925.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;