Protein coding transcript 99796

• Transcript: Ll_transcript_528461
• CDS coordinates: 149-832 (+)
• Peptide sequence: MISQFFILSQRGDNIVFRDYRGEVQKGSAEIFFRKVKFWEDGGLEEAPPVFNVDGVNYFHVKVVGLLFVATTRVNVSPSFVLELLQRIARVTKDYLGVLNEDSLRKNFVLVYELLDEVIDFGYVQTTSTELLKSYVFNEPLVVDAARLPALGPASIFAQGTKRMPGIAVTKSVVATELGGRKREEIFVDIIEKISITFSSSVSTYILFDFEYHNFGCILFDLSCSRV*
• ORF Type: complete

Annotations of Ll_transcript_528461

• Blastp: AP-4 complex subunit mu from Arabidopsis with 82.61% of identity
• Blastx: AP-4 complex subunit mu from Arabidopsis with 82.61% of identity
• Eggnog: Adaptor-related protein complex(ENOG410XPFS)
• Kegg: Link to kegg annotations (AT4G24550)
• CantataDB: Link to cantataDB annotations (CNT0002502)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431272.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;