Protein coding transcript 99934

• Transcript: Ll_transcript_461664
• CDS coordinates: 1648-2487 (+)
• Peptide sequence: MLLIEPYSIVRSIQPTIPSEISLLLALKLLCRVHKFLCRISGYFSFSSGRCISNHDKVIFSWAVFQINQVKFQLTPEIKYQIFALKPAVHQAFLKFVPSKMSEVDFWNKYFKAEYLHSTKNAVAAAAEAAEDEDLAVFLKDDEILEVESRKKVRRVDPTLDMEADEGDDYTHLPDHGLFRDGSKEISGAQNTLYQRTLLQDLNRQGAVVLEGKTLDMEMEPPRTVAEALARRKQGESDGAVEEERRIRISKMTQIEDLQAQNDHHFAPLCIKVHLCPKN*
• ORF Type: complete

Annotations of Ll_transcript_461664

• Blastp: Probable RNA polymerase II transcription factor B subunit 1-1 from Arabidopsis with 61.32% of identity
• Blastx: Probable RNA polymerase II transcription factor B subunit 1-1 from Arabidopsis with 48.73% of identity
• Eggnog: Transcription factor(ENOG410XRI6)
• Kegg: Link to kegg annotations (AT1G55750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441065.1)
• Pfam: BSD domain (PF03909.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;