Transcript | Ll_transcript_461667 |
---|---|
CDS coordinates | 164-850 (+) |
Peptide sequence | MEMEPPRTVAEVLARRKQGESDGVVEEERSNRISKMAQIEDLQAQNDHHFAPLCIKDPREYFDSQQVNAVKTLYDSQAGTEKIRCSLTSEEAYGSLRASISNIKAKGLRDPLFSHEVALKALDGLTKNISSTKYHLGKNSQESVLDILPKATKEKLLDHWVCSQELLRHFWSSYPITTQNLASKTKRLRDAMSQVYSKLEEIKVSAQSDLRHQVSLVVHPMQQTLDAAS |
ORF Type | 3prime_partial |
Blastp | Probable RNA polymerase II transcription factor B subunit 1-1 from Arabidopsis with 51.07% of identity |
---|---|
Blastx | Probable RNA polymerase II transcription factor B subunit 1-1 from Arabidopsis with 52% of identity |
Eggnog | Transcription factor(ENOG410XRI6) |
Kegg | Link to kegg annotations (AT1G55750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462269.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer