Protein coding transcript 99938

• Transcript: Ll_transcript_461667
• CDS coordinates: 164-850 (+)
• Peptide sequence: MEMEPPRTVAEVLARRKQGESDGVVEEERSNRISKMAQIEDLQAQNDHHFAPLCIKDPREYFDSQQVNAVKTLYDSQAGTEKIRCSLTSEEAYGSLRASISNIKAKGLRDPLFSHEVALKALDGLTKNISSTKYHLGKNSQESVLDILPKATKEKLLDHWVCSQELLRHFWSSYPITTQNLASKTKRLRDAMSQVYSKLEEIKVSAQSDLRHQVSLVVHPMQQTLDAAS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_461667

• Blastp: Probable RNA polymerase II transcription factor B subunit 1-1 from Arabidopsis with 51.07% of identity
• Blastx: Probable RNA polymerase II transcription factor B subunit 1-1 from Arabidopsis with 52% of identity
• Eggnog: Transcription factor(ENOG410XRI6)
• Kegg: Link to kegg annotations (AT1G55750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462269.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;