Protein coding transcript 99945

• Transcript: Ll_transcript_461676
• CDS coordinates: 218-1417 (+)
• Peptide sequence: MSSGQVIKRAKYKTTVKDPGTPGVIKLTGEKFVFRPNDPTSHNKLEVDFRLIKSHKNTKEGSNKPPWLNLTHSQGSYIFELESFSDLHVCRDLVGVALSKHGEAAKVISEEQLSPAEMALRIKLLQEDSKLQKLHKELVASGKLTESEFWATKKKLLDRDESRKLKQRIGYKNSLIFDTKPTSDGRINQVKFQLTPEIKYQIFALKPAVHQAFLKFVPSKMSEVDFWNKYFKAEYLHSTKNAVAAAAEAAEDEDLAVFLKDDEILEVESRKKVRRVDPTLDMEADEGDDYTHLPDHGLFRDGSKEISGAQNTLYQRTLLQDLNRQGAVVLEGKTLDMEMEPPRTVAEALARRKQGESDGAVEEERRIRISKMTQIEDLQAQNDHHFAPLCIKVHLCPKN*
• ORF Type: complete

Annotations of Ll_transcript_461676

• Blastp: Probable RNA polymerase II transcription factor B subunit 1-1 from Arabidopsis with 57.46% of identity
• Blastx: Probable RNA polymerase II transcription factor B subunit 1-1 from Arabidopsis with 50.42% of identity
• Eggnog: Transcription factor(ENOG410XRI6)
• Kegg: Link to kegg annotations (AT1G55750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441065.1)
• Pfam: Short C-terminal domain (PF09851.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;