Transcript | Ll_transcript_478388 |
---|---|
CDS coordinates | 23-760 (+) |
Peptide sequence | MNSLMEVVGSLLVLTLSTLLLPGAYSASITIKNNCPFTIWPGALSGASTAQLSSTGFELASQASQTIDVPEKWSGRFWGRRQCSNANGKFVCGNGDCGSGQVACNGAGGAPPVSLAEFTLSGFGSQDFYDVSLVDGYNLPVSIAPQKGGCQSTICPKDVNTVCPQELALKGSDGGIIGCKSACMALNQPQYCCSGAFNTPDKCPPTNYSKIFKDQCPQAYSYAYDDKTSTFTCPAGGNYVVTFCP* |
ORF Type | complete |
Blastp | Thaumatin-like protein 1a from Malus with 60% of identity |
---|---|
Blastx | Thaumatin-like protein 1 from Pyrus with 65.49% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (103411735) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425007.1) |
Pfam | Thaumatin family (PF00314.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer