Protein coding transcript 99994

• Transcript: Ll_transcript_460365
• CDS coordinates: 255-770 (+)
• Peptide sequence: MEMGTVACAFFLIFTTVFCSDSSFALTQDGVTLLEIKSTLNDTKNVLSNWQELDESPCRWTGITCHPGEQRVREINLPYMQLGGIISPSIGNLSRLQRLALHQNGLHGIIPNEITNCSELRALYLRANYFQGGIPSNIGKLPFLNILDLSSNLLKGAIPSTIGGLSHLQVL*
• ORF Type: complete

Annotations of Ll_transcript_460365

• Blastp: LRR receptor-like serine/threonine-protein kinase FEI 1 from Arabidopsis with 39.86% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase FEI 1 from Arabidopsis with 39.86% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G31420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451111.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;