Protein coding transcript 1084

• Transcript: Ll_transcript_477493
• CDS coordinates: 194-679 (+)
• Peptide sequence: MKHKTSKLAKYIKHVMAVLNITRWIDLNRKKMVNKTMLKDNMTKTWHELSGQDHWKGLLDPLDIDMRHYIIQYGELAQSAYDAFITEKASKYAGGSRYAKRDFFSKVGLEKGNPLKYSVTKFLYATSSIPLPDAFVIKSLSREAWSKESNWIGFVAVCTDEG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_477493

• Blastp: Phospholipase A1-IIgamma from Arabidopsis with 57.38% of identity
• Blastx: Phospholipase A1-IIgamma from Arabidopsis with 57.38% of identity
• Eggnog: Lipase class 3 family protein(COG3675)
• Kegg: Link to kegg annotations (AT4G18550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440209.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;