Protein coding transcript 1092

• Transcript: Ll_transcript_389812
• CDS coordinates: 120-452 (+)
• Peptide sequence: MGRDPSPGADIEVQIHPRRRGSDPPLSPPLNPITTDERDHDFSLFKRWFPWLVPSFVVANIAIFIITMYINDCPKHSFPDSSCVASFFGRFSFQPLKENPLFGPSSATLGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_389812

• Blastp: RHOMBOID-like protein 1 from Arabidopsis with 64.79% of identity
• Blastx: RHOMBOID-like protein 1 from Arabidopsis with 64.79% of identity
• Eggnog: rhomboid family(COG0705)
• Kegg: Link to kegg annotations (AT2G29050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458543.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;