Protein coding transcript 129845

• Transcript: Ll_transcript_264884
• CDS coordinates: 53-529 (+)
• Peptide sequence: MTNSKGYRHGTRDLFSRRFRRHGVIPLSTYMKVYKVGDRVDIKGNGAVQKGMPYKVYHGKTGRVFNVSKHALGVIVNKRVRNRIIAKRINIRIEHVNPSKCRDDFLRRVKENEEKVADAKKKGIRVCLKRKPQGPRPGHIVRGTDPISLAPLPYEFIA*
• ORF Type: complete

Annotations of Ll_transcript_264884

• Blastp: 60S ribosomal protein L21 from Homo with 63.12% of identity
• Blastx: 60S ribosomal protein L21 from Homo with 63.12% of identity
• Eggnog: (ribosomal) protein(COG2139)
• Kegg: Link to kegg annotations (6144)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444134.1)
• Pfam: Ribosomal protein L21e (PF01157.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;