| Transcript | Ll_transcript_239802 |
|---|---|
| CDS coordinates | 3-335 (-) |
| Peptide sequence | AMELQPSFLLIIILVLILMSCLAKIYKLLPILMSCLAKIYKQKGKVVNILPPGPWKLPIIGNLHQLAWESSLPHRALRDLANKYGPLMHFQFGEISAVVVSSPEMAKQILK |
| ORF Type | internal |
| Blastp | Cytochrome P450 71D7 from Solanum with 75.81% of identity |
|---|---|
| Blastx | Cytochrome P450 71D7 from Solanum with 75.81% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450522.1) |
| Pfam | Cytochrome P450 (PF00067.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer