Protein coding transcript 129855

• Transcript: Ll_transcript_127464
• CDS coordinates: 72-686 (+)
• Peptide sequence: MGAYKYIQELYRKKQSDVLRFLLRIRVWQYRQLTKLHRAPRPTRPDKARRMGYRAKQGYVIFRIRVRRGGRKRPVPKGATYGKPKCHGVNELKPVRNLQSIAEERVGRRCGGLRVLNSYWVAQDSSYKYFEIILVDPSHNAIRRDPKINWIVSAVQKHRELRGLTSAGKSSRGLGKGHRYSQTKGGSRRAAWLRRNSLQLRRKR*
• ORF Type: complete

Annotations of Ll_transcript_127464

• Blastp: 60S ribosomal protein L15 from Sophophora with 82.84% of identity
• Blastx: 60S ribosomal protein L15 from Chironomus with 80.88% of identity
• Eggnog: Ribosomal protein L15(COG1632)
• Kegg: Link to kegg annotations (Dmel_CG17420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003549922.2)
• Pfam: Ribosomal L15 (PF00827.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;