Protein coding transcript 129856

• Transcript: Ll_transcript_179784
• CDS coordinates: 92-1495 (+)
• Peptide sequence: MKPGDMFAYLGSIIASFMFFWAMFERYFPSQLIKQFEKYSQRLVTLIYPYIQITFHEFTGERMMRSEAFSAIENYLSSKASTQAKRLKGDIAKNNQSLVLSMDDHEEVADEFNGIKLWWASGKHVMKSHSISFNHMTDEKRYYKLTFHKYHRDVILGTYLNYVMKEGNDIKVKNRQRKLYTNNGSYWSHVVFQHPATFQTLAMEPKEKELIIDDLITFSKSGDFYAGIGRAWKRGYLLYGPPGTGKSTMIAAMANLLGYDLYDLELTNVKDNTELRKLLIETSSKSIIVIEDIDCSLDLTGQRRKKREKREEEEEKDPRQKQQGMEESEGKNSKVTLSGLLNFIDGLWSACGGERLIVFTTNYVEKLDPALVRKGRMDKHIELSYCGFEAFKLLAKNYLKIESHHLFGTICELLKETKITPAEVAEHLMPKTSSGDAELYLKSLIQALELAKEEANLKSEEVATKSD*
• ORF Type: complete

Annotations of Ll_transcript_179784

• Blastp: AAA-ATPase ASD, mitochondrial from Arabidopsis with 60.57% of identity
• Blastx: AAA-ATPase ASD, mitochondrial from Arabidopsis with 60.57% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT5G40010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442623.1)
• Pfam: Domain associated at C-terminal with AAA (PF14363.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;