Protein coding transcript 129862

• Transcript: Ll_transcript_46235
• CDS coordinates: 234-605 (+)
• Peptide sequence: MAGIGKGFIDFEDLLPMIANKLGFDGLINELCNGFQLLMDKDKGVITLDSLRNNSILLGLYDLEEDELVSMMREGDIDGDGALSQMEFCVLMFRLSPQLMEESWFWIEDAIHEQFNDHSDASI*
• ORF Type: complete

Annotations of Ll_transcript_46235

• Blastp: Calcium-binding protein PBP1 from Arabidopsis with 60.55% of identity
• Blastx: Calcium-binding protein PBP1 from Arabidopsis with 55.96% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT5G54490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457710.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;