Protein coding transcript 129899

• Transcript: Ll_transcript_48404
• CDS coordinates: 1-354 (-)
• Peptide sequence: MGLAKVGYVLGLRVVPHHRRKGIGSSLVQRLEEWFISNDVDYAYMATEKDNYASVSLFMDKFGYTKFRTPAILVNPVNHHSFQISSNIDIARLKIEQAESLYRRFMSSAEFFPIDIDN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_48404

• Blastp: Probable N-acetyltransferase HLS1 from Arabidopsis with 55.26% of identity
• Blastx: Probable N-acetyltransferase HLS1 from Arabidopsis with 43.09% of identity
• Eggnog: Acetyltransferase (GNAT) family(ENOG410YF8W)
• Kegg: Link to kegg annotations (AT4G37580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418256.1)
• Pfam: Acetyltransferase (GNAT) family (PF00583.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;