Protein coding transcript 129901

• Transcript: Ll_transcript_183391
• CDS coordinates: 2-346 (+)
• Peptide sequence: KVSTPIPLSASLSQSLRPQKCFFISFQPSINSKPYHLSSSPHPLKPSLRVKCSQTGGNGIAAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIFQKAISSS
• ORF Type: internal

Annotations of Ll_transcript_183391

• Blastp: Transaldolase from Trichodesmium with 50% of identity
• Blastx: Transaldolase from Trichodesmium with 50% of identity
• Eggnog: Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway (By similarity)(COG0176)
• Kegg: Link to kegg annotations (Tery_0683)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429562.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;