Protein coding transcript 129903

• Transcript: Ll_transcript_216541
• CDS coordinates: 112-867 (+)
• Peptide sequence: MKLNVSYPATGSQKLFEIVDEHKLRVFYEKRIGTEVEVDILGDEWKGYVLKISGGNDKQGFPMKQGVLSNVRVRLLLSKGHSCYRPRRDGERKRKSVRGCIVDSNLSVLSLVVVKKGEKDIAGLTDTNVPRRLGPKRANKIRKLFNLQKEDDVRKYVIKRPLPLKEGKTKQHFKAPKIQRLITPVRLQRKRHNLALKKKRCLKRKEQATEYAKLLAHRQKEKLAKKRAEQSRKRTMSQSSVSSSGTKSSKK*
• ORF Type: complete

Annotations of Ll_transcript_216541

• Blastp: 40S ribosomal protein S6 from Spodoptera with 72.73% of identity
• Blastx: 40S ribosomal protein S6 from Spodoptera with 77.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013448504.1)
• Pfam: Ribosomal protein S6e (PF01092.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;