Protein coding transcript 129905

• Transcript: Ll_transcript_216542
• CDS coordinates: 1-465 (+)
• Peptide sequence: AQAFVRMSQLGLGLATAGAIVNSALFNVDGGFRAVIFDRFKGVKQDVIGEGTHFFVPWVQRPILFDIRSRARNVPVVTGSKDLQNVNITLRILFRPVPKELPRIYTILGEDYTERVLPSITTEVLKAVVAQFDAGELITQRELVSQKVTDDLMER
• ORF Type: internal

Annotations of Ll_transcript_216542

• Blastp: Protein l(2)37Cc from Sophophora with 74.84% of identity
• Blastx: Protein l(2)37Cc from Sophophora with 74.84% of identity
• Eggnog: Band 7 protein(COG0330)
• Kegg: Link to kegg annotations (Dmel_CG10691)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020997619.1)
• Pfam: SPFH domain / Band 7 family (PF01145.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;