Protein coding transcript 129908

• Transcript: Ll_transcript_243598
• CDS coordinates: 1-468 (-)
• Peptide sequence: VLLLKFLTLHEVFSIIQLLLCLLSGLSNCTLIKELYISGNRISDVEGLHRLLKLTVLDLRFNKITTTKAIGQLVANYNSLQVLNLIGNPIQRNIGDNQLRKVVSGLLPKIVDLNKQPIKPQRARQVITHSFGKAALGNNCRNINRKARKKGGQRSS
• ORF Type: internal

Annotations of Ll_transcript_243598

• Blastp: Leucine-rich repeat-containing protein 46 from Rattus with 41.67% of identity
• Blastx: Leucine-rich repeat-containing protein 46 from Rattus with 45.24% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (287653)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004500636.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;