Protein coding transcript 1741

• Transcript: Ll_transcript_318086
• CDS coordinates: 82-420 (+)
• Peptide sequence: MTCVILSTLFVYITRADKKGVAIVKHIKKGVNPASASEIFFSGKYLSAGARIGVVAGMVALTEAVAIGRTFASMKDYSLDGNKEMVALGTMNIIGSLTSCYVATGSYSRTAVN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_318086

• Blastp: High affinity sulfate transporter 2 from Stylosanthes with 81.42% of identity
• Blastx: High affinity sulfate transporter 2 from Stylosanthes with 80.47% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418102.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;